H00008227-D01P

AKAP17A antibody from Abnova Corporation
721P, CCDC133, CXYorf3, DXYS155E, MGC39904, SFRS17A, XE7, XE7Y

Antibody data

Product number
H00008227-D01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00008227-D01P, RRID:AB_1707625
Product name
SFRS17A purified MaxPab rabbit polyclonal antibody (D01P)
Provider product page
Abnova Corporation - H00008227-D01P
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against a full-length human SFRS17A protein.
Antigen sequence
MAAATIVHDTSEAVELCPAYGLYLKPITKMTISVA
LPQLKQPGKSISNWEVMERLKGMVQNHQFSTLRIS
KSTMDFIRFEGEVENKSLVKSFLACLDGKTIKLSG
FSDILKVRAAEFKIDFPTRHDWDSFFRDAKDMNET
LPGERPDTIHLEGLPCKWFALKESGSEKPSEDVLV
KVFEKFGEIRNVDIPMLDSYREEMTGRNFHTFSFG
GHLNFEAYVQYREYMGFIQAMSALRGMKLMYKGED
GKAVACNIKVSFDSTKHLSDASIKKRQLERQKLQE
LEQQREEQKRREKEAEERQRAEERKQKELEELERE
RKREEKLRKREQKQRDRELRRNQKKLEKLQAEEQK
QLQEKIKLEERKLLLAQRNLQSIRLIAELLSRAKV
PGGSLCSRQPRPGCPQCPPLKCGRRHGAVSPPAAA
VATKPALMPRMTAPSREGVALVCRSR
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -