Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [3]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN311014 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Profilin 1 (PFN1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Porcine
- Host
- Rabbit
- Antigen sequence
AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVP
GKTFV NITPAEVGVL- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Reversal of myofibroblastic activation by polyunsaturated fatty acids in valvular interstitial cells from aortic valves. Role of RhoA/G-actin/MRTF signalling.
Control of the ability of profilin to bind and facilitate nucleotide exchange from G-actin.
Witt W, Büttner P, Jannasch A, Matschke K, Waldow T
Journal of molecular and cellular cardiology 2014 Sep;74:127-38
Journal of molecular and cellular cardiology 2014 Sep;74:127-38
Control of the ability of profilin to bind and facilitate nucleotide exchange from G-actin.
Wen KK, McKane M, Houtman JC, Rubenstein PA
The Journal of biological chemistry 2008 Apr 4;283(14):9444-53
The Journal of biological chemistry 2008 Apr 4;283(14):9444-53
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting