HPA023924

RPAIN antibody from MilliporeSigma / Merck KGaA
hRIP, MGC4189, RIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA023924
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA023924, RRID:AB_10601890
Product name
Anti-RPAIN antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA023924
Antibody type
Polyclonal
Antigen
RPA interacting protein recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YNLRITSGVVVCQCGLSIPSHSSELTEQKLRACLE
GSINEHSAHCPHTPEFSVTGGTEEKSSLLMSCLAC
DTWAVI
Storage
-20C
Provider Type Product Number
- No reagents -