Antibody data

Product number
H00053347-M25
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00053347-M25, RRID:AB_1581626
Product name
UBASH3A monoclonal antibody (M25), clone 1G6
Provider product page
Abnova Corporation - H00053347-M25
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant UBASH3A.
Antigen sequence
MDRCTASMVQIVNTCPQDTGVILIVSHGSTLDSCT
RPLLGLPPRECGDFAQLVRKIPSLGMCFCEENKEE
GKWELVNPPVKTLTHGANAAFNWRNWISGN
Isotype
IgG
Antibody clone number
1G6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -