Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN310636 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-SIL1 Homolog, Endoplasmic Reticulum Chaperone (S. Cerevisiae) (SIL1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SIL1 antibody: synthetic peptide directed towards the N terminal of human SIL1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Xenopus
- Host
- Rabbit
- Antigen sequence
KETKAEEELDAEVLEVFHPTHEWQALQPGQAVPAG
SHVRL NLQTGEREAK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references The gene disrupted in Marinesco-Sjögren syndrome encodes SIL1, an HSPA5 cochaperone.
Anttonen AK, Mahjneh I, Hämäläinen RH, Lagier-Tourenne C, Kopra O, Waris L, Anttonen M, Joensuu T, Kalimo H, Paetau A, Tranebjaerg L, Chaigne D, Koenig M, Eeg-Olofsson O, Udd B, Somer M, Somer H, Lehesjoki AE
Nature genetics 2005 Dec;37(12):1309-11
Nature genetics 2005 Dec;37(12):1309-11
No comments: Submit comment
No validations: Submit validation data