ABIN632312

antibody from antibodies-online

Targeting: SAMD4A DKFZP434H0350, hSmaug1, KIAA1053, SAMD4, Smaug, SMG, SMGA

Western blot

Antibody data

Submit

Validation data

Product number: ABIN632312 - Provider product page
Provider: antibodies-online
Product name: anti-Sterile alpha Motif Domain Containing 4A (SAMD4A) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: SAMD4 A antibody was raised using the middle region of SAMD4 corresponding to a region with amino acids LKSLRLHKYAALFSQMTYEEMMALTECQLEAQNVTKGARHKIVISIQKLK
Description: Affinity purified
Reactivity: Human, Mouse, Rat
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

SAMD4A protein structure - ABIN632312 shown in red.