HPA010634

TRAF2 antibody from Sigma-Aldrich
TRAP3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010634
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010634, RRID:AB_1080347
Product name
Anti-TRAF2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010634
Antibody type
Polyclonal
Antigen
TNF receptor-associated factor 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASI
LSSGPQNCAACVHEGIYEEGISILESSSAFPDNAA
RREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPL
MLTECPACKGLVRLGEKERHLEHECPERSLSCRHC
RAPC
Storage
-20C
Provider Type Product Number
- No reagents -