HPA010510

LECT1 antibody from Sigma-Aldrich
BRICD3, CHM-I, CHM1, chondromodulin, MYETS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010510
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010510, RRID:AB_10602021
Product name
Anti-LECT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010510
Antibody type
Polyclonal
Antigen
leukocyte cell derived chemotaxin 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSI
SSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSS
KVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVP
TTTKRPHSGPRSNPGAGRLNNETRPSVQ
Storage
-20C
Provider Type Product Number
- No reagents -