H00003845-M03

KRAS antibody from Abnova Corporation
KRAS1, KRAS2
No application information provided.

Antibody data

Product number
H00003845-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003845-M03, RRID:AB_1137279
Product name
KRAS monoclonal antibody (M03), clone 4B6
Provider product page
Abnova Corporation - H00003845-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KRAS.
Antigen sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGET
CLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAIN
NTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTV
Isotype
IgG
Antibody clone number
4B6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -