Antibody data

Product number
H00003955-M05A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003955-M05A, RRID:AB_1576797
Product name
LFNG monoclonal antibody (M05A), clone 3C4
Provider product page
Abnova Corporation - H00003955-M05A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant LFNG.
Antigen sequence
MTPGRCCLAADIQVETFIFTDGEDEALARHTGNVV
ITNCSAAHSRQALSCKMAVEYDRFIESGRKWFCHV
DDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRPI
QAMERVSENKVRPVHFWFATGGAGFCISRGLALKM
SPWASGGHFMNTAERIRLPDDCTIGYIVEALLGVP
LIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFEN
KRNAVHVKGPFSVEADPSRFRSIHCHLYPDTPWCP
RTAIF
Isotype
IgG
Antibody clone number
3C4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -