HPA011219

RARRES3 antibody from Sigma-Aldrich
HRASLS4, TIG3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011219
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011219, RRID:AB_1856082
Product name
Anti-RARRES3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011219
Antibody type
Polyclonal
Antigen
Retinoic acid receptor responder protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDV
VGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQK
MKYSIVSRNCEHFVTQLRYGKSRCKQVEK
Storage
-20C
Provider Type Product Number
- No reagents -