HPA008968

B4GALNT1 antibody from Sigma-Aldrich
beta1-4GalNAc-T, GALGT, SPG26
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008968
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008968, RRID:AB_1078253
Product name
Anti-B4GALNT1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008968
Antibody type
Polyclonal
Antigen
beta-1,4 N-Acetylgalactosaminyltransferase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGG
LPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQ
AFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLR
SILVPGLSLQAASGQE
Storage
-20C
Provider Type Product Number
- No reagents -