HPA003459

SEPT11 antibody from Sigma-Aldrich
FLJ10849
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA003459
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA003459, RRID:AB_1856696
Product name
Anti-SEPT11 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA003459
Antibody type
Polyclonal
Antigen
Septin-11 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
KSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFES
DPATHNEPGVRLKARSYELQESNVRLKLTIVDTVG
FGDQINKDDSYKPIVEYIDAQ
Storage
-20C
Provider Type Product Number
- No reagents -