Explore
Validate
Learn
ImmunocytochemistryAntibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA041028 - Provider product page
- Provider
- Atlas Antibodies
- Product name
- Anti-IFNE
- Antibody type
- Polyclonal
- Antigen
- Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Description
- Affinity purified using the PrEST antigen as affinity ligand
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
FQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLP
QKSLSPQQYQKGHTLAILHE- Isotype
- IgG
- Vial size
- 100μl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection
The mucosal expression pattern of interferon-ε in rhesus macaques.
Månberg A, Bradley F, Qundos U, Guthrie B, Birse K, Noël-Romas L, Lindskog C, Bosire R, Kiarie J, Farquhar C, Burgener A, Nilsson P, Broliden K
Molecular & Cellular Proteomics 2019;18(3):461-476
Molecular & Cellular Proteomics 2019;18(3):461-476
The mucosal expression pattern of interferon-ε in rhesus macaques.
Demers A, Kang G, Ma F, Lu W, Yuan Z, Li Y, Lewis M, Kraiselburd EN, Montaner L, Li Q
Journal of leukocyte biology 2014 Dec;96(6):1101-7
Journal of leukocyte biology 2014 Dec;96(6):1101-7
No comments: Submit comment
No validations: Submit validation data