HPA017281

FAM69A antibody from Sigma-Aldrich
FLJ23493
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017281
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017281, RRID:AB_1848406
Product name
Anti-FAM69A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017281
Antibody type
Polyclonal
Antigen
Protein FAM69A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IICDKYKTGVIDGPACNSLCVTETLYFGKCLSTKP
NNQMYLGIWDNLPGVVKCQMEQALHLDFGTELEPR
KEIVLFDKPTRGTTVQKFKEMVYSLFKAKLGDQGN
LSELVNLILTVADGDKDGQVSLGEAKSAWA
Storage
-20C
Provider Type Product Number
- No reagents -