H00065083-B02

NOL6 antibody from Abnova Corporation
bA311H10.1, FLJ21959, MGC14896, MGC14921, MGC20838, Nrap, UTP22

Antibody data

Product number
H00065083-B02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00065083-B02, RRID:AB_1138717
Product name
NOL6 MaxPab mouse polyclonal antibody (B02)
Provider product page
Abnova Corporation - H00065083-B02
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NOL6 protein.
Antigen sequence
MGPAPAGEQLRGATGEPEVMEPALEGTGKEGKKAS
SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELN
RLRETEILFHSSLLRLQVEELLKEVRLSEKKKDRI
DAFLREVNQRVVRVPSVPETELTDQAWLPAGVRVP
LHQVPYAVKGCFRFLPPAQVTVVGSYLLGTCIRPD
INVDVALTMPREILQDKDGLNQRYFRKRALYLAHL
AHHLAQDPLFGSVCFSYTNGCHLKPSLLLRPRGKD
ERLVTVRLHPCPPPDFFRPCRLLPTKNNVRSAWYR
GQSPAGDGSPEPPTPRYNTWVLQDTVLESHLQLLS
TILSSAQGLKDGVALLKVWLRQRELDKGQGGFTGF
LVSMLVVFLVSTRKIHTTMSGYQVLRSVLQFLDLT
VNGISLCLSSDPSLPALADFHQAFSVVFLDSSGHL
NLCADVTASTYHQVQHEARLSMMLLDSRADDGFHL
LLMTPKPMIRAFDHVLHLRPLSRLQAACHRLKLWP
ELQDNGGDYVSAALGPLTTLLEQGLGARLNLLAHS
RPPVPEWDISQDPPKHKDSGTLTLGLLLRPEGLTS
VLELGPEADQPEAAKFRQFWGSRSELRRFQDGAIR
EAVVWEAASMSQKRLIPHQVVTHLLALHADIPETC
VHYVGGPLDALIQGLKETSSTGEEALVAAVRCYDD
LSRLLWGLEGLPLTVSAVQGAHPVLRYTEVFPPTP
VRPAFSFYETLRERSSLLPRLDKPCPAYVEPMTVV
CHLEGSGQWPQDAEAVQRVRAAFQLRLAELLTQQH
GLQCRATATHTDVLKDGFVFRIRVAYQREPQILKE
VQSPEGMISLRDTAASLRLERDTRQLPLLTSALHG
LQQQHPAFSGVARLAKRWVRAQLLGEGFADESLDL
VAAALFLHPEPFTPPSSPQVGFLRFLFLVSTFDWK
NNPLFVNLNNELTVEEQVEIRSGFLAARAQLPVMV
IVTPQDRKNSVWTQDGPSAQILQQLVVLAAEALPM
LEKQLMDPRGPGDIRTVFRPPLDIYDVLIRLSPRH
IPRHRQAVDSPAASFCRGLLSQPGPSSLMPVLGYD
PPQLYLTQLREAFGDLALFFYDQHGGEVIGVLWKP
TSFQPQPFKASSTKGRMVMSRGGELVMVPNVEAIL
EDFAVLGEGLVQTVEARSERWTV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -