Antibody data

Product number
ABIN405825
Provider
antibodies-online
Product name
anti-Interleukin 11 Receptor, alpha (IL11RA) (Middle Region) antibody
Provider product page
antibodies-online - ABIN405825
Antibody type
Polyclonal
Antigen
The immunogen for anti-IL11RA antibody: synthetic peptide directed towards the middle region of human IL11RA
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine
Host
Rabbit
Antigen sequence
FLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAG
LPHAV RVSARDFLDA
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -