H00050846-M01

DHH antibody from Abnova Corporation
HHG-3, MGC35145

Antibody data

Product number
H00050846-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00050846-M01, RRID:AB_1137173
Product name
DHH monoclonal antibody (M01), clone 4F10
Provider product page
Abnova Corporation - H00050846-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant DHH.
Antigen sequence
SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLD
RDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGP
APAPGDFAPVFARRLRAGDSVLAPGGDALRP*
Isotype
IgG
Antibody clone number
4F10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -