H00005880-M01A

RAC2 antibody from Abnova Corporation
EN-7
No application information provided.

Antibody data

Product number
H00005880-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00005880-M01A, RRID:AB_1016891
Product name
RAC2 monoclonal antibody (M01A), clone 3B10-2D9
Provider product page
Abnova Corporation - H00005880-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant RAC2.
Antigen sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPT
VFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPL
SYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHC
PSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYP
QGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRA
VLCPQPTRQQKRACSLL
Isotype
IgM
Antibody clone number
3B10-2D9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -