Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406058 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-serine Peptidase Inhibitor, Kunitz Type, 2 (SPINT2) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SPINT2 antibody: synthetic peptide directed towards the middle region of human SPINT2
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
MLRCFRQQENPPLPLGSKVVVLAGLFVMVLILFLG
ASMVY LIRVARRNQE- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Regulation of hepatocyte growth factor activator inhibitor 2 by hypoxia in breast cancer.
Generali D, Fox SB, Berruti A, Moore JW, Brizzi MP, Patel N, Allevi G, Bonardi S, Aguggini S, Bersiga A, Campo L, Dogliotti L, Bottini A, Harris AL
Clinical cancer research : an official journal of the American Association for Cancer Research 2007 Jan 15;13(2 Pt 1):550-8
Clinical cancer research : an official journal of the American Association for Cancer Research 2007 Jan 15;13(2 Pt 1):550-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting