Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406170 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Cell Division Cycle 45 Homolog (S. Cerevisiae) (CDC45) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CDC45L antibody: synthetic peptide directed towards the C terminal of human CDC45L
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
VTVVGIPPETDSSDRKNFFGRAFEKAAESTSSRML
HNHFD LSVIELKAED- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Irinotecan pharmacogenetics: influence of pharmacodynamic genes.
Hoskins JM, Marcuello E, Altes A, Marsh S, Maxwell T, Van Booven DJ, Paré L, Culverhouse R, McLeod HL, Baiget M
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Mar 15;14(6):1788-96
Clinical cancer research : an official journal of the American Association for Cancer Research 2008 Mar 15;14(6):1788-96
No comments: Submit comment
No validations: Submit validation data