HPA027755

MAP2K5 antibody from Sigma-Aldrich
HsT17454, MAPKK5, MEK5, PRKMK5
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027755
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027755, RRID:AB_10600883
Product name
Anti-MAP2K5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027755
Antibody type
Polyclonal
Antigen
mitogen-activated protein kinase kinase 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IFPRACKPPGERNIHGLKVNTRAGPSQHSSPAVSD
SLPSNSLKKSSAELKKILANGQMNEQDIRYRDTLG
HGNG
Storage
-20C
Provider Type Product Number
- No reagents -