HPA000635

HMOX1 antibody from Sigma-Aldrich
bK286B10, HO-1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000635
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000635, RRID:AB_1079089
Product name
Anti-HMOX1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000635
Antibody type
Polyclonal
Antigen
Heme oxygenase 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRD
GFKLVMASLYHIYVALEEEIERNKESPVFAPVYFP
EELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYV
KRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKI
AQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSR
MNSLEMTPAVRQRVIEEAKTAF
Storage
-20C
Provider Type Product Number
- No reagents -