HPA017589

FAM73A antibody from Sigma-Aldrich
FLJ35093
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017589
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017589, RRID:AB_1848409
Product name
Anti-FAM73A antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017589
Antibody type
Polyclonal
Antigen
Protein FAM73A recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QEEFEATLGASDPNSLADDIDKDTDITMKGNVEDF
GLRDTLSIASTDSFASAAELAEHREVRHTYSLESL
CHCPFYEEAMHLVEEGKIYSRVLRTEMLECLGDSD
FLAKLHCIRQAFQVILSESANR
Storage
-20C
Provider Type Product Number
- No reagents -