H00051237-B02P

MZB1 antibody from Abnova Corporation
HSPC190, MEDA-7, MGC29506, PACAP, pERp1

Antibody data

Product number
H00051237-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00051237-B02P, RRID:AB_1577716
Product name
MGC29506 purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00051237-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC29506 protein.
Antigen sequence
MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLD
DEEMYSAHMPAHLRCDACRAVAYQMWQNLAKAETK
LHTSNSGGRRELSELVYTDVLDRSCSRNWQDYGVR
EVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLS
RTCLHYLGEFGEDQIYEAHQQGRGALEALLCGGPQ
GACSEKVSATREEL
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -