HPA000647

FAM109B antibody from Sigma-Aldrich
DKFZp686J07229
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA000647
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA000647, RRID:AB_1078800
Product name
Anti-FAM109B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA000647
Antibody type
Polyclonal
Antigen
Protein FAM109B recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
AWVKVLSRASFGYMRLVVRELESQLQDARQSLALQ
RRSSWKSVASRCKPQAPNHRAAGLENGHCLSKDSS
PVGLVEEAGSRSAGWGLAEWELQGPASLLLGKGQS
PVSPETSCFSTLHDWYGQEIVELRQCWQKRAQGSH
SKCEEQ
Storage
-20C
Provider Type Product Number
- No reagents -