HPA014750

LAMP1 antibody from Sigma-Aldrich
CD107a
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014750
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014750, RRID:AB_1846219
Product name
Anti-LAMP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014750
Antibody type
Polyclonal
Antigen
Lysosome-associated membrane glycoprotein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYE
RKDNTTVTRLLNINPNKTSASGSCGAHLVTLELHS
EGTTVLLFQFGMNASSSRFFLQGIQLNTILPDARD
PAFKAANGSLRALQATVGNSYKCN
Storage
-20C
Provider Type Product Number
- No reagents -