Antibody data

Product number
ABIN636063
Provider
antibodies-online
Product name
anti-Transmembrane (C-terminal) Protease, serine 12 (TMPRSS12) (Middle Region) antibody
Provider product page
antibodies-online - ABIN636063
Antibody type
Polyclonal
Antigen
TMPRSS12 antibody was raised using the middle region of TMPRSS12 corresponding to a region with amino acids KEEGNATNILQDAEVHYISREMCNSERSYGGIIPNTSFCAGDEDGAFDTC
Description
Affinity purified
Reactivity
Human
Host
Rabbit
Epitope
Middle Region
Vial size
50 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Provider Type Product Number
- No reagents -