T8050-45H
antibody from United States Biological
Targeting: TLR5
FLJ10052, MGC126430, MGC126431, SLEB1, TIL3
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- T8050-45H - Provider product page
- Provider
- United States Biological
- Product name
- TLR5 (Toll-like Receptor 5, Toll/Interleukin-1 Receptor-like Protein 3, TIL3)
- Antibody type
- Polyclonal
- Antigen
- Synthetic peptide corresponding to aa151-181 (CDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQ) of human TLR5 (Genbank accession no. NP_003259).
- Description
- Serum
- Host
- Rabbit
- Isotype
- IgG
- Vial size
- 100µl
- Concentration
- Not determined.
- Storage
- -20°C
No comments: Submit comment
No validations: Submit validation data