Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501413 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Purinergic Receptor P2X, Ligand Gated Ion Channel 2 (P2RX2) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-P2RX2 antibody: synthetic peptide directed towards the N terminal of human P2RX2
- Description
- Affinity Purified
- Reactivity
- Human, Bovine
- Host
- Rabbit
- Antigen sequence
DGASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGN
IADRT DGYLKRCTFH- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Gaseous and particulate polycyclic aromatic hydrocarbons (PAHs) emissions from commercial restaurants in Hong Kong.
Go it alone no more--P2X7 joins the society of heteromeric ATP-gated receptor channels.
Chen Y, Ho KF, Ho SS, Ho WK, Lee SC, Yu JZ, Sit EH
Journal of environmental monitoring : JEM 2007 Dec;9(12):1402-9
Journal of environmental monitoring : JEM 2007 Dec;9(12):1402-9
Go it alone no more--P2X7 joins the society of heteromeric ATP-gated receptor channels.
Dubyak GR
Molecular pharmacology 2007 Dec;72(6):1402-5
Molecular pharmacology 2007 Dec;72(6):1402-5
No comments: Submit comment
No validations: Submit validation data