Antibody data

Product number
ABIN311351
Provider
antibodies-online
Product name
anti-delta/notch-Like EGF Repeat Containing (DNER) (Middle Region) antibody
Provider product page
antibodies-online - ABIN311351
Antibody type
Polyclonal
Antigen
The immunogen for anti-DNER antibody: synthetic peptide directed towards the middle region of human DNER
Description
Protein A purified
Reactivity
Human, Mouse
Host
Rabbit
Antigen sequence
DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYT
GELCQ SKIDYCILDP
Epitope
Middle Region
Vial size
100 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -