AV46395

OSMR antibody from Sigma-Aldrich
OSMRB
No application information provided.

Antibody data

Product number
AV46395
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#AV46395, RRID:AB_1854819
Product name
Anti-OSMR antibody produced in rabbit
Provider product page
Sigma-Aldrich - AV46395
Antibody type
Polyclonal
Antigen
synthetic peptide corresponding to a region of human OSMR with an internal ID of P27179
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SLKVSTNSTRQSLHLQWTVHNLPYHQELKMVFQIQ
ISRIETSNVIWVGNY
Storage
-20C
Provider Type Product Number
- No reagents -