Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN635854 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-delta-Like 1 Homolog (Drosophila) (DLK1) antibody
- Antibody type
- Polyclonal
- Antigen
- DLK1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLLT
- Description
- Affinity purified
- Reactivity
- Human, Mouse, Rat
- Host
- Rabbit
- Vial size
- 50 μg
- Concentration
- 1 mg/mL
- Storage
- Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
- Handling
- Avoid repeated freeze/thaw cycles.
No comments: Submit comment
No validations: Submit validation data