HPA010600

PSTPIP1 antibody from Sigma-Aldrich
CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPAS, PSTPIP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010600
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010600, RRID:AB_1855870
Product name
Anti-PSTPIP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010600
Antibody type
Polyclonal
Antigen
Proline-serine-threonine phosphatase-interacting protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GMIKRFSGLLHGSPKTTSLAASAASTETLTPTPER
NEGVYTAIAVQEIQGNPASPAQEYRALYDYTAQNP
DELDLSAGDILEVILEGEDGWWTVERNGQRGFVPG
SYLEK
Storage
-20C
Provider Type Product Number
- No reagents -