H00112616-M01A

CMTM7 antibody from Abnova Corporation
CKLFSF7, FLJ30992
No application information provided.

Antibody data

Product number
H00112616-M01A
Provider
Abnova Corporation
Product name
CMTM7 monoclonal antibody (M01A), clone S1
Provider product page
Abnova Corporation - H00112616-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant CMTM7.
Antigen sequence
MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGL
LDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTN
YSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTC
ISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGL
VAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
Isotype
IgG
Antibody clone number
S1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -