H00056896-B01P

DPYSL5 antibody from Abnova Corporation
CRAM, CRMP-5, CRMP5, CV2, Ulip6

Antibody data

Product number
H00056896-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00056896-B01P, RRID:AB_1573352
Product name
DPYSL5 purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00056896-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human DPYSL5 protein.
Antigen sequence
MLANSASVRILIKGGKVVNDDCTHEADVYIENGII
QQVGRELMIPGGAKVIDATGKLVIPGGIDTSTHFH
QTFMNATCVDDFYHGTKAALVGGTTMIIGHVLPDK
ETSLVDAYEKCRGLADPKVCCDYALHVGITWWAPK
VKAEMETLVREKGVNSFQMFMTYKDLYMLRDSELY
QVLHACKDIGAIARVHAENGELVAEGAKEALDLGI
TGPEGIEISRPEELEAEATHRVITIANRTHCPIYL
VNVSSISAGDVIAAAKMQGKVVLAETTTAHATLTG
LHYYHQDWSHAAAYVTVPPLRLDTNTSTYLMSLLA
NDTLNIVASDHRPFTTKQKAMGKEDFTKIPHGVSG
VQDRMSVIWERGVVGGKMDENRFVAVTSSNAAKLL
NLYPRKGRIIPGADADVVVWDPEATKTISASTQVQ
GGDFNLYENMRCHGVPLVTISRGRVVYENGVFMCA
EGTGKFCPLRSFPDTVYKKLVQREKTLKVRGVDRT
PYLGDVAVVVHPGKKEMGTPLADTPTRPVTRHGGM
RDLHESSFSLSGSQIDDHVPKRASARILAPPGGRS
SGIW
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -