ABIN633501

antibody from antibodies-online

Targeting: APOBEC2 ARCD1, ARP1

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633501 - Provider product page
Provider: antibodies-online
Product name: anti-Apolipoprotein B MRNA Editing Enzyme, Catalytic Polypeptide-Like 2 (APOBEC2) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: ApoBEC2 antibody was raised using the middle region of APOBEC2 corresponding to a region with amino acids CKLRIMKPQDFEYVWQNFVEQEEGESKAFQPWEDIQENFLYYEEKLADIL
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

APOBEC2 protein structure - ABIN633501 shown in red.