H00084961-M03

FBXL20 antibody from Abnova Corporation
Fbl2, Fbl20, MGC15482

Antibody data

Product number
H00084961-M03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00084961-M03, RRID:AB_1237702
Product name
FBXL20 monoclonal antibody (M03), clone 2G1
Provider product page
Abnova Corporation - H00084961-M03
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant FBXL20.
Antigen sequence
MRRDVNGVTKSRFEMFSNSDEAVINKKLPKELLLR
IFSFLDVVTLCRCAQVSRAWNVLALDGSNWQRIDL
FDFQRDIEGRVVENISKRCGGFLRKLSLRGCLGVG
DNALRTFAQNCRNIEVLNLNGCTKTTDATCTSLSK
FCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLN
ISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLED
EALKYIGAHCPELVTLNLQTCLQITDEGLITICRG
CHKLQSLCASGCSNITDAILNALGQNCPRLRILEV
ARCSQLTDVGFTTLARNCHELEKMDLEECVQITDS
TLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGA
CAHDQLEVIELDNCPLITDASLEHLKSCHSLERIE
LYDCQQITRAGIKRLRTHLPNIKVHAYFAPVTPPP
SVGGSRQRFCRCCIIL
Isotype
IgG
Antibody clone number
2G1
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -