Antibody data

Product number
H00010728-M02
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00010728-M02, RRID:AB_1137000
Product name
PTGES3 monoclonal antibody (M02), clone 3C6-2B9
Provider product page
Abnova Corporation - H00010728-M02
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PTGES3.
Antigen sequence
MQPASAKWYDRRDYVFIEFCVEDSKDVNVNFEKSK
LTFSCLGGSDNFKHLNEIDLFHCIDPNDSKHKRTD
RSILCCLRKGESGQSWPRLTKERAKLNWLSVDFNN
WKDWEDDSDEDMSNFDRFSEMMNNMGGDEDVDLPE
VDGADDDSQDSDDEKMPDLE
Isotype
IgG
Antibody clone number
3C6-2B9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -