Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406407 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Ferritin, Heavy Polypeptide 1 (FTH1) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FTH1 antibody: synthetic peptide directed towards the middle region of human FTH1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Rabbit
- Host
- Rabbit
- Antigen sequence
NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVK
AIKEL GDHVTNLRKM- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Fungal iron availability during deep seated candidiasis is defined by a complex interplay involving systemic and local events.
Ferritin L and H subunits are differentially regulated on a post-transcriptional level.
Potrykus J, Stead D, Maccallum DM, Urgast DS, Raab A, van Rooijen N, Feldmann J, Brown AJ
PLoS pathogens 2013;9(10):e1003676
PLoS pathogens 2013;9(10):e1003676
Ferritin L and H subunits are differentially regulated on a post-transcriptional level.
Sammarco MC, Ditch S, Banerjee A, Grabczyk E
The Journal of biological chemistry 2008 Feb 22;283(8):4578-87
The Journal of biological chemistry 2008 Feb 22;283(8):4578-87
No comments: Submit comment
No validations: Submit validation data