ABIN406407

FTH1 antibody from antibodies-online
FHC, FTH, FTHL6, PIG15, PLIF

Antibody data

Product number
ABIN406407
Provider
antibodies-online
Product name
anti-Ferritin, Heavy Polypeptide 1 (FTH1) (Middle Region) antibody
Provider product page
antibodies-online - ABIN406407
Antibody type
Polyclonal
Antigen
The immunogen for anti-FTH1 antibody: synthetic peptide directed towards the middle region of human FTH1
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Canine, Chicken/Avian, Porcine, Rabbit
Host
Rabbit
Antigen sequence
NVNQSLLELHKLATDKNDPHLCDFIETHYLNEQVK
AIKEL GDHVTNLRKM
Epitope
Middle Region
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -