Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406067 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Tenomodulin (TNMD) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-TNMD antibody: synthetic peptide directed towards the N terminal of human TNMD
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Porcine, Rabbit, Zebrafish
- Host
- Rabbit
- Antigen sequence
KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNG
YTGIY FVGLQKCFIK- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Tenomodulin is associated with obesity and diabetes risk: the Finnish diabetes prevention study.
Tolppanen AM, Pulkkinen L, Kolehmainen M, Schwab U, Lindström J, Tuomilehto J, Uusitupa M, Finnish Diabetes Prevention Study Group
Obesity (Silver Spring, Md.) 2007 May;15(5):1082-8
Obesity (Silver Spring, Md.) 2007 May;15(5):1082-8
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- Image(s): Western Blotting