PAB20675

GABBR2 antibody from Abnova Corporation
GABABR2, GPR51, GPRC3B, HG20

Antibody data

Product number
PAB20675
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20675, RRID:AB_10963866
Product name
GABBR2 polyclonal antibody
Provider product page
Abnova Corporation - PAB20675
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant GABBR2.
Antigen sequence
SKTSTSVTSVNQASTSRLEGLQSENHRLRMKITEL
DKDLEEVTMQLQDTPEKTTYIKQNHYQELNDILNL
GNFTESTDGGKAILKNHLDQNPQLQWNTTEPSRTC
KDPIEDINSPEHIQRRLSLQLPI
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -