HPA001242

RGAG1 antibody from Sigma-Aldrich
KIAA1318, Mar9, Mart9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001242
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001242, RRID:AB_1079804
Product name
Anti-RGAG1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001242
Antibody type
Polyclonal
Antigen
Retrotransposon gag domain-containing protein 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TSTLLMRDTASGVMSCPQMRSLASGALSKPLMTPK
ASGTMFTEKMTTTASEAMPTLLMRDTVSGALSMPQ
MTDTASGGLSASLMRDTASGAMSTSQMTATVSGGM
SMPLMRAQDPGVMPASLMRAKVSGKMLSQPMSTQD
PGGMSM
Storage
-20C
Provider Type Product Number
- No reagents -