Antibody data

Product number
ABIN504602
Provider
antibodies-online
Product name
anti-G Protein-Coupled Receptor 18 (GPR18) antibody
Provider product page
antibodies-online - ABIN504602
Antibody type
Polyclonal
Antigen
The immunogen for anti-GPR18 antibody: synthetic peptide directed towards the middle region of human GPR18
Reactivity
Human
Host
Rabbit
Antigen sequence
GVWIMTLTTTTPLLLLYKDPDKDSTPATCLKISDI
IYLKA VNVLNLTRLT
Vial size
50 µg
Provider Type Product Number
- No reagents -