H00057215-M01

THAP11 antibody from Abnova Corporation
CTG-B43a, CTG-B45d, HRIHFB2206

Antibody data

Product number
H00057215-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00057215-M01, RRID:AB_1581320
Product name
THAP11 monoclonal antibody (M01), clone 3C11
Provider product page
Abnova Corporation - H00057215-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant THAP11.
Antigen sequence
MPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRL
WLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRK
TYTVRVPTIFPLRGV
Isotype
IgG
Antibody clone number
3C11
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -