Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- EPAF-1006LC - Provider product page
- Provider
- Creative Biolabs
- Product name
- Recombinant Human Anti-C5AR1 Antibody
- Antibody type
- Monoclonal
- Description
- This product is a human monoclonal antibody that specifically recognizes MNSFNYTTPDYGHYDDKDTLDLNTPVDKTSN, which is an linear epitope on C5a anaphylatoxin chemotactic receptor from Human. The C5AR1-binding antibody is an epitope-specific antibody that can be used in blocking study.
- Reactivity
- Human
No comments: Submit comment
No validations: Submit validation data