HPA018123

TES antibody from Sigma-Aldrich
DKFZP586B2022, TESS-2, TESTIN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA018123
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA018123, RRID:AB_1857900
Product name
Anti-TES antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA018123
Antibody type
Polyclonal
Antigen
Testin recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFC
CFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQ
GCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKC
LIGQKFMPVEGMVFCSVECKK
Storage
-20C
Provider Type Product Number
- No reagents -