HPA014063

MARCH2 antibody from Sigma-Aldrich
HSPC240, MARCH-II, RNF172
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014063
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014063, RRID:AB_1853576
Product name
Anti-MARCH2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014063
Antibody type
Polyclonal
Antigen
E3 ubiquitin-protein ligase MARCH2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
RYHCQLYSEWRKTNQKVRLKIREADSPEGPQHSPL
AAGLLKKVAEETPV
Storage
-20C
Provider Type Product Number
- No reagents -