HPA014585

TMEM261 antibody from Atlas Antibodies
C9orf123, MGC4730
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA014585
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA014585, RRID:AB_1233649
Product name
Anti-TMEM261
Provider product page
Atlas Antibodies - HPA014585
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
MGSRLSQPFESYITAPPGTAAAPAKPAPPATPGAP
TSPAEHRLLKTCWSC
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -