ABIN503513

GUCA1A antibody from antibodies-online
C6orf131, COD3, CORD14, dJ139D8.6, GCAP, GCAP1, GUCA, GUCA1

Antibody data

Product number
ABIN503513
Provider
antibodies-online
Product name
anti-Guanylate Cyclase Activator 1A (Retina) (GUCA1A) (N-Term) antibody
Provider product page
antibodies-online - ABIN503513
Antibody type
Polyclonal
Antigen
The immunogen for anti-GUCA1A antibody: synthetic peptide directed towards the N terminal of human GUCA1A
Description
Affinity Purified
Reactivity
Human, Mouse, Rat, Bovine, Canine, Chicken/Avian
Host
Rabbit
Antigen sequence
LYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGY
IDFME YVAALSLVLK
Epitope
N-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -